Marleka Identity Labs is currently under development

DNA analysis services are not yet available. Our ancestry analysis platform will launch soon. We currently do not accept DNA file uploads or process payments.

Start Your Journey

Start Your Journey

Discover the complete picture of your genetic heritage with professional-grade analysis

Choose Your Package

Professional genetic analysis designed specifically for Rusyn and Eastern European ancestry

Basic

Essential ancestry analysis

$30one-time
  • Ancestry Report
  • Closest Population Matches
  • Access to G25 Calculators
  • AI Assistant
  • Heat Maps
  • G25 Coordinates for Calculators
  • Fully Customizable Advanced Report
MOST POPULAR

Premium

Deep ancestry insights

$40one-time
  • Ancestry Report
  • Closest Population Matches
  • Heat Maps
  • G25 Coordinates for Calculators
  • AI Assistant
  • Access to G25 Calculators
  • Fully Customizable Advanced Report
  • Manual Population Adjustments
BEST FEATURES

Premium Plus

Full control & precision

$45one-time
  • Ancestry Report
  • Closest Population Matches
  • Heat Maps
  • G25 Coordinates for Calculators
  • AI Assistant
  • Access to G25 Calculators
  • Fully Customizable Advanced Report
  • Manual Population Adjustments

All plans are one-time purchases. No subscriptions. No hidden fees.

What You Get

Detailed Report

Comprehensive breakdown of your genetic heritage with visualizations and detailed analysis.

Genetic Maps

Interactive maps showing your genetic connections to populations across Europe.

AI Description

AI-generated narrative explaining your ancestry in clear, understandable language.

Population Matches

Find your closest genetic matches among historical and modern populations.

Heat Map

Visual heat map showing genetic density across regions (Advanced only).

G25 Coordinates

Your unique G25 coordinates to use in our free calculators (Advanced only).

Sample Report

See what your advanced ancestry report looks like

G25 Genetic Analysis
Advanced Analysis · 10,000 Iterations

Advanced Ancestry
DNA Report

Comprehensive genetic ancestry analysis powered by Global25 coordinates

Sample ID

Sample — Carpathian Heritage

Distance Metric

euclidean

Fit Quality

Excellent

98.2%

Fit Score

10

Components

0.0182

Distance

AI ANCESTRY ANALYSIS

Powered by Professor Misha™ · Genetic Intelligence Engine

Live Analysis
Professor Misha

Prof. Misha

AI Analyst

🐾 "I've completed the genetic analysis for Sample — Carpathian Heritage. Here's what your DNA reveals!"

The genetic profile for Sample — Carpathian Heritage tells a story with one unmistakable headline: a powerful and deeply rooted Carpathian Rusyn ancestry. When all Rusyn sub-populations are combined — Rusyn (38.2%), Lemko (18.4%), Boyko (11.7%) — the total Carpathian Rusyn component reaches 68.3%, making it by far the single most defining genetic signal in this entire profile. The Rusyns, Lemkos, Boykos, Hutsuls, and Dolinyans are the indigenous Slavic highlanders of the Eastern Carpathian arc — one of the most genetically cohesive and geographically isolated populations in all of Central Europe, with roots predating the medieval Slavic expansion.

A combined 68.3% Carpathian Rusyn ancestry is a rare and extraordinary genetic signature. Individuals with this level of Rusyn heritage are genetically traceable to one of the most ancient and isolated mountain communities in Europe — the highland valleys of northeastern Slovakia, western Ukraine, and southeastern Poland. The secondary signal — 19.6% Eastern European — provides important context: Eastern European populations span the vast plains and river valleys from Poland and the Czech lands through Ukraine, Moldova, and Romania. Their DNA reflects deep Slavic roots shaped by medieval kingdoms, Cossack migrations, and centuries of demographic exchange.

The remaining ancestry — 8.3% Slovak, 7.1% Polish, 5.9% Ukrainian, 4.2% Czech — rounds out a profile shaped by historical population movements across the Carpathian basin and broader Central Europe. But the defining story here is clear: with 68.3% combined Carpathian Rusyn ancestry, this individual carries one of the most distinctive and historically significant genetic signatures in all of European population genetics.

Have questions? Ask Professor Misha directly!

Ancestry Composition

Your genetic makeup broken down by regional group

Carpathian Rusyn

The Rusyns, Lemkos, Boyko, Hutsul, and Dolinyan are mountain peoples who have lived in the Carpathian highlands for thousands of years. They are one of the oldest surviving communities in Eastern Europe, with a unique culture, language, and genetic identity that sets them apart from their neighbors.

68.3%
Rusyn38.2%

The Rusyns (also called Ruthenians, Carpatho-Rusyns, or historically Rutheni) are the indigenous Slavic people of the Eastern Carpathian mountain arc, with their historical heartland spanning four modern countries: the Prešov Region (Subcarpathian Ruthenia) of northeastern Slovakia, Zakarpattia Oblast of western Ukraine, the Lemko and Boyko regions of southeastern Poland (Galicia), and the Maramureș/Bucovina borderlands of northern Romania. They are one of the least-assimilated Slavic peoples in Europe, with a distinct identity that has survived successive rulerships under the Kingdom of Hungary, Habsburg Austria, Czechoslovakia, and Soviet Ukraine without full absorption into any neighboring national identity. Three historical forces shaped the Rusyn genetic and cultural profile in profound ways: **White Croat Origin.** The scholarly and genetic consensus increasingly supports the Rusyns as the direct descendants of the White Croats (Bijeli Hrvati / Bílí Chorvati) — the northern Slavic tribal confederation whose homeland sat in exactly the Rusyn ethnographic zone: the northern Carpathian arc from the Tatras east through Subcarpathia. When a portion of the White Croats migrated south in the 7th century to become Dalmatian/Pannonian Croats, those who remained in the Carpathians evolved into the Rusyn/Ruthenian ethnic group. The White Croat homeland corresponds almost exactly with the Rusyn ethnographic zone: the Lemko region of the western Carpathians, the Prešov Region of eastern Slovakia, Subcarpathian Ruthenia (Zakarpattia), and the Boyko and Hutsul zones of the Eastern Carpathians. Genetically, White Croat samples display a distinctive North Carpathian profile: elevated East Slavic/Carpathian Ukrainian affinity, a strong West Slavic Czech-Slovak component from Carpathian proximity, and notably reduced Dinaric/Balkan signals compared to Dalmatian or Slavonian Croats. This Carpathian North Slavic ancestry profile is the ancestral genetic baseline from which both modern Rusyns and Croats ultimately descend.

Lemko18.4%

The Lemkos are the westernmost Rusyn subgroup, historically inhabiting the Low Beskid mountains from the Poprad river in southeastern Poland westward into northeastern Slovakia. Of all Carpatho-Rusyn groups, Lemkos show the strongest genetic affinity to West Slavic populations — in G25 PCA space they cluster notably close to Czechs, Moravians, and Slovaks, a clear reflection of their position at the western extreme of the Carpathian arc where the Rusyn ethnographic zone meets the Slovak and Polish linguistic frontiers. This Czech/Slovak proximity is one of the key features that visually distinguishes the Lemko cluster from Boykos and Hutsuls on admixture plots. A second distinctive signal is a detectable Romanian/Vlach-adjacent component, a legacy of the 14th–17th century Wallachian colonization (Walachian migration wave) that moved northward through the Carpathians, introducing a Romanian-proximate genetic trace into the western Beskids — the same shepherd migration corridor that left comparable signals in Maramureș and the Hutsul zone. Lemkos thus occupy a unique crossroads: overwhelmingly Rusyn in their East Slavic Carpathian core, yet measurably West Slavic-adjacent in a way no other Rusyn subgroup is, and carrying a faint Vlach thread that ties them southward to the Carpathian Wallachian world.

Boyko11.7%

The Boykos are the central Carpathian Rusyn subgroup, inhabiting the Bieszczady and Eastern Beskid mountains straddling southeastern Poland and western Ukraine (Lviv, Ivano-Frankivsk, and Zakarpattia oblasts). Genetically, the Boyko profile sits at the midpoint of the Rusyn east–west cline: more East Slavic-shifted than Lemkos, but less so than Hutsuls. The Boyko zone borders Galician Ukrainian territories to the north and east, and this contact is genetically visible — Boykos show measurably elevated Ukrainian/Galician admixture relative to Lemkos, with a West Ukrainian genetic pull that does not appear in the western Beskids. On PCA plots Boykos occupy a position intermediate between the Slovak/Czech-proximate Lemko cluster and the distinctly Ukrainian-trending Hutsul cluster, making them a useful reference for tracing the Carpathian Rusyn genetic gradient from west to east. A possible pre-Slavic Iron Age Celtic/Dacian substrate has been proposed for this zone, as the central Carpathian region was within the Hallstatt and La Tène cultural sphere before Slavic settlement, but this signal is subtle and partially obscured by the dominant medieval Slavic demographic replacement.

Eastern European

Eastern European populations span the vast plains and river valleys from Poland and the Czech lands through Ukraine, Moldova, and Romania. Their DNA reflects deep Slavic roots shaped by medieval kingdoms, Cossack migrations, and centuries of demographic exchange.

19.6%
Slovak8.3%

Slovakia Lemkos are the Lemko communities of eastern Slovakia, sharing the distinctive Rusyn genetic profile of the western Carpathian arc. Their genetic profile mirrors the broader Lemko signature — strong West Slavic (Czech/Slovak) proximity relative to other Rusyn groups — but with an additional layer of Slovak admixture from centuries of coexistence with Slovak-speaking communities in the Prešov lowlands. The Slovakia Lemko sample typically shows the highest Slovak genetic affinity of any Rusyn sub-population, sitting closest to eastern Slovaks (particularly Šariš and Zemplín districts) on PCA plots while retaining the core Rusyn Carpathian East Slavic baseline. The Akcja Wisła deportation of 1947 affected primarily Polish Lemkos, leaving the Slovakia Lemko community less demographically disrupted, which contributes to the relative genetic cohesion of this sample.

Polish7.1%

Polish Lesser Poland represents the core genetic profile of Małopolska — the south-central Polish historic heartland around Kraków. As a G25 reference population it captures the dominant Corded Ware/Bronze Age Steppe ancestry of the medieval Polish demographic baseline, Neolithic Anatolian farmer layers from the Lengyel Culture, and the standard West Slavic cluster position intermediate between Czechs/Slovaks and more northerly Polish populations. The slight Carpathian proximity produces a faint East Slavic-adjacent pull that distinguishes this sample from Great Polish or Mazovian samples to the northwest. Lesser Poland is the genetic anchor of the core Polish ancestral profile — the territory where Polish national identity and statehood crystallized in the Piast and Jagiellonian periods.

Czech4.2%

České Budějovice (German: Budweis) is the regional capital of South Bohemia, situated on the confluence of the Vltava and Malše rivers at the southwestern corner of Bohemia — the closest major Bohemian city to Bavaria and Austria, where Czech, German, and Austrian cultural worlds have historically converged most intensely. As a key node on the salt trade route connecting Linz and Trieste to Bohemia and a major Habsburg administrative center, Budweis was shaped by deep and sustained ties to the Austrian and Bavarian German world. Dense German-speaking (Sudeten German) settlement throughout the South Bohemian countryside persisted from the medieval colonization through the 1945 expulsions, making the region one of the most thoroughly German-settled parts of the Bohemian periphery. Genetically, the České Budějovice sample represents the core West Slavic Czech-Bohemian baseline — dominant Bronze Age Corded Ware/Steppe ancestry and strong Neolithic Anatolian farmer layers — but carries a slight Germanic-adjacent uplift compared to central Bohemian populations, consistent with centuries of Sudeten German settlement in the surrounding South Bohemian countryside and the city's deep Habsburg integration with the Austrian world. This makes South Bohemia one of the westernmost and most Germanic-influenced Czech regional samples.

Other

Populations from outside the primary genetic clusters.

9.0%
Ukrainian5.9%

Ukrainian is a reference population within the Other genetic cluster. Populations from outside the primary genetic clusters.

Hungarian3.1%

The Székelys (Hungarian: Székelyek; Romanian: Secui) are a Hungarian ethnographic subgroup concentrated in the eastern Transylvanian highlands — the Székely Land (Székelyföld), centered on modern Harghita and Covasna counties of Romania. Speaking Hungarian and identifying strongly as a distinct Hungarian ethnic group, the Székelys have inhabited the Eastern Carpathian fringe since at least the high medieval period, where they served as a border-guarding military community for the Hungarian Kingdom. Their precise ethnic origin remains debated: some scholars link them to early Turkic steppe groups (Avars, Khazars) absorbed into the early Magyar tribal confederation, while others consider them a frontier Magyar group with specific settlement history. Genetically, the Székely population shows the characteristic Pannonian Hungarian core — elevated Bronze Age Steppe ancestry from the Magyar conquest (895 CE), the Uralic/Siberian East Eurasian component that distinguishes Hungarians from all Slavic and Germanic neighbors, and the Neolithic Anatolian farmer layer of the broader Central European baseline. Compared to western Hungarian populations, the Székelys show measurable additional Transylvanian layering: a detectable Dacian/Thracian-adjacent ancient Balkan substratum inherited through deep settlement in the Eastern Carpathians, a slight Romanian/Vlach admixture signal from centuries of coexistence with Transylvanian Romanians, and proximity to the broader Carpathian genetic arc. The Székely profile therefore represents the easternmost and most Carpathian-influenced variant of the Hungarian genetic world — the Hungarian identity rooted in the mountains of Transylvania rather than the Pannonian plain.

Balkan

Serbs, Croats, Bulgarians, Macedonians, and Vlachs are the South Slavic and Balkan peoples. Their DNA tells a story of ancient migrations, Byzantine influence, and centuries of living at the crossroads of East and West.

3.1%
Romanian2.1%

Romanian Maramureș (Maramures) is a remote mountainous region in northwestern Romania, nestled in the northern Carpathians along the border with Ukraine. While Romanians form the demographic majority, Maramureș has historically been home to a significant Rusyn (Ruthenian) population, particularly concentrated in the upper Tisza valley villages — including Ruscova (Ruscăova), Poienile de sub Munte, Repedea, and Bistra. These communities represent one of the southernmost Rusyn ethnographic enclaves, historically connected to the broader Carpatho-Rusyn world of Subcarpathian Ruthenia (Zakarpattia), Prešov Region in Slovakia, and Lemko Rusyns of Poland. Genetically, Romanian Maramureș samples show a distinctive North Carpathian admixture signal that distinguishes them from lowland Moldavian or Wallachian Romanians — the Rusyn villages in particular pull the regional sample toward an East Slavic/Carpathian Ukrainian direction, reflecting centuries of Rusyn demographic presence and endogamy. The region was also a major center of the Greek Catholic (Uniate) church, which served as the primary religious and cultural institution binding Rusyn communities across the Carpathian arc. Maramureș thus sits at a unique Carpathian crossroads of Romanian, Rusyn/Ruthenian, and Hungarian (Marmaros) historical spheres.

Serbian1.0%

The Serbians are the South Slavic people of the central and western Balkans, whose medieval Kingdom and later Empire (under Stefan Dušan, 1346–1355) dominated the Balkan peninsula before the Ottoman conquest. The Serbian genetic profile is characterized by a strong Dinaric South Slavic signature: Bronze Age Corded Ware/Steppe ancestry from the 6th–7th century Slavic migration overlaid on the ancient Illyrian/Thracian/Roman Balkan substratum. Serbians cluster centrally within the South Slavic genetic space alongside Croats, Bosnians, and Montenegrins, with a measurably elevated Dinaric/Balkan ancient ancestry component compared to more northerly Slavic populations. Regional variation exists on a significant north-south axis: northern Vojvodina Serbs show elevated Pannonian/Central European admixture from Habsburg-era colonization, while southern Serbs in the Morava valley and Raška region carry more ancient Balkan substratum ancestry.

Genetic Density Heat Map

Ancestry concentration by geographic region

Leaflet © OpenStreetMap contributors

Intensity Scale

Very High 40%+
High 20–40%
Medium 8–20%
Low 2–8%
Trace <2%

European PCA Genetic Plot

Principal Component Analysis — PC2 (x) vs PC1 (y) · your position marked in red

Closest cluster: Slovakia
FIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIEEEEEEEEEEEEEEEEEEEEEEEEEEEEEELVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLTLTLTLTLTLTLTLTLTLTLTLTLTLTLTRURURURURURURURURURURURURURURURURURURURURURURURURURURURUUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUAUABYBYBYBYBYBYBYBYBYBYBYBYBYBYISISISISISISISISISISFOFOFOFOFOFOFOFOIEIEIEIEIEIEIEIEIEIEIEIEIEIEIEIEIEIEIEIEWAWAWAWAWAWAWAWAWAWAWAWAWAWAWAWAWAWAGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBNONONONONONONONONONONONONONONONONONOSESESESESESESESESESESESESESESESESESESESEDKDKDKDKDKDKDKDKDKDKDKDKDKDKDKDKNLNLNLNLNLNLNLNLNLNLNLNLNLNLBEBEBEBEBEBEBEBEBEBEBEBEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEATATATATATATATATATATATATATATCHCHCHCHCHCHCHCHCHCHCHCHFRFRFRFRFRFRFRFRFRFRFRFRFRFRFRFRFRFRFRFRPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLCZCZCZCZCZCZCZCZCZCZCZCZCZCZCZCZCZCZSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSISISISISISISISISISISISIHUHUHUHUHUHUHUHUHUHUHUHUHUHUHUHUHUHUHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSRSROROROROROROROROROROROROROROROROROROROROBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGMKMKMKMKMKMKMKMKMKMKMKMKALALALALALALALALALALALALKOKOKOKOKOKOKOKOKOKOKOKOGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRMTMTMTMTMTMTMTMTCYCYCYCYCYCYCYCYCYCYITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITITESESESESESESESESESESESESESESESESESESESESESESESESESESESESESESPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRTRGIGIGIGIGIFIEELVLTRUUABYISFOIEWAGBNOSEDKNLBEDEATCHFRPLCZSKSIHUHRRSROBGMKALKOGRMTCYITESPTTRGICLOSESTYOU-0.02-0.010.010.020.030.04Principal Component 2-0.04-0.020.02Principal Component 1
YOU
Baltic / Finnish
East Slavic
British / Atlantic
Scandinavian
Central European
Central Slavic
SE European
S. Balkans
Mediterranean
Turkey

Phylogenetic Dendrogram

Sample — Carpathian Heritage · 10 populations · UPGMA clustering

YOU
Cluster A
Cluster B
Cluster C
Cluster D
Cluster E
Cluster F
Click any row to highlight · Toggle 3D view

Genetic Distance Reference

0.0182

Best Fit Distance

Closest Population: Rusyn

847

Reference Populations

Tested Against

25

Genetic Dimensions

G25 Coordinates

Closest Populations

Ranked by genetic distance (lower = closer match)

🥇
1st Place
🇸🇰Rusyn
Carpathian Rusyn
90.0%

match

d = 0.0100

modern
🥈
2nd Place
🇸🇰Lemko
Carpathian Rusyn
82.2%

match

d = 0.0178

modern
🥉
3rd Place
🇺🇦Boyko
Carpathian Rusyn
74.4%

match

d = 0.0256

modern
#1
🇸🇰
RusynCarpathian Rusynmodern
d = 0.010090.0%
#2
🇸🇰
LemkoCarpathian Rusynmodern
d = 0.017882.2%
#3
🇺🇦
BoykoCarpathian Rusynmodern
d = 0.025674.4%
#4
🇸🇰
SlovakEastern Europeanmodern
d = 0.033366.7%
#5
🇵🇱
PolishEastern Europeanmodern
d = 0.041158.9%
#6
🇺🇦
UkrainianOthermodern
d = 0.048951.1%
#7
🇨🇿
CzechEastern Europeanmodern
d = 0.056743.3%
#8
🇭🇺
HungarianOthermodern
d = 0.064435.6%
#9
🇷🇴
RomanianBalkanmodern
d = 0.072227.8%
#10
🇷🇸
SerbianBalkanmodern
d = 0.080020.0%

About This Report

This report is based on autosomal DNA analysis using Global25 coordinates and Monte Carlo optimization with 10,000 iterations. Results represent genetic similarity to reference populations and should be interpreted as part of a broader understanding of ancestry. Genetic ancestry is complex and may not align perfectly with cultural, linguistic, or national identities. Best-fit distance of 0.01820 (Excellent quality) using euclidean metric.

Global Reference Panel

WHAT SETS US APART

Reference Populations Found
Nowhere Else

Our advanced reports are powered by a global reference panel spanning every continent — including rare populations that major commercial DNA tests simply don't carry. No matter your background, our proven algorithm delivers precise, meaningful results.

Worldwide Reference Panel

Hundreds of reference populations from every corner of the world — from the Carpathian highlands to Central Asia, Sub-Saharan Africa, the Americas, and beyond.

Specialists in the Overlooked

Built for people who get vague results from big-box tests. We specialize in under-represented populations — especially Vlach-Rusyn DNA — with granular regional distinctions.

Proven for All Ethnicities

Our algorithm has been rigorously tested and validated across all major ethnic groups worldwide. Whether your roots are in Eastern Europe, the Middle East, East Asia, or the Americas.

Regions in our reference panel

Carpathian RusynVlach-RusynLemkoBoykoHutsulSlovakPolishUkrainianBalkanSouth SlavicBalticScandinavianIberianCaucasianMiddle EasternCentral AsianEast AsianSouth AsianNorth AfricanSub-Saharan AfricanNative AmericanAshkenazi JewishSephardic Jewish

Order Your Test

Upload your raw DNA and we'll handle the rest

1
Your Info
2
Upload DNA
3
Payment
4
Confirmation

Frequently Asked Questions

How long does the analysis take?

After uploading your raw DNA file, analysis typically takes 24–48 hours. You'll receive an email notification when your report is ready.

What's the difference between Basic and Advanced?

The Basic package includes all essential analysis features. The Advanced package adds heat map visualization, your G25 coordinates for use in our free calculators, and a detailed migratory map showing ancestral movement patterns.

Is my data secure?

Yes. All data is encrypted and stored according to the highest security standards. We never share your personal or genetic data without your explicit consent.

What are G25 coordinates?

G25 is an advanced genetic model that represents your heritage in 25-dimensional space. These coordinates allow for very precise comparisons with historical and contemporary populations in our free calculators.

Can I upgrade to Advanced later?

Yes! You can upgrade from Basic to Advanced at any time by paying only the $15 difference.